PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_50895.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 655aa    MW: 72271.3 Da    PI: 4.4453
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_50895.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM49.71.2e-15711961127
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk......leleevikevd....iykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                   lp+G++F+P+d++l+  +L++++ +        +  +e+ik+ d       ++P+d+p  ++++ + +yfF+++ + +++++   +   +  W+++g
  MLOC_50895.3  71 LPRGVQFNPSDSDLL-WHLAAEMGNGLahrhpfI--SEFIKSGDegarFGCTHPRDMP-GMRQDGNALYFFHRKVSLHNNEN--DK---DISWQKSG 158
                   699************.667777665553454331..3345544344448899******.677888999****9988765433..33...335***** PP

           NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                    +++++  +g l g k+++++y + ++++++tdW +h y 
  MLOC_50895.3 159 PSRSIIL-DGGLQGYKEIFTLY-AFKNSPQRTDWELHRYG 196
                   *******.999***********.5677779********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-2064215IPR003441NAC domain
PROSITE profilePS5100521.70371215IPR003441NAC domain
PfamPF023658.3E-772196IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MAFDIDSLPP LLGPDSDSDS DHLPPAPRRG RPLRPSPAPR VEPSPPTTDR CEATPAPEGT  60
GGAAQQSWPG LPRGVQFNPS DSDLLWHLAA EMGNGLAHRH PFISEFIKSG DEGARFGCTH  120
PRDMPGMRQD GNALYFFHRK VSLHNNENDK DISWQKSGPS RSIILDGGLQ GYKEIFTLYA  180
FKNSPQRTDW ELHRYGIKNT MEGEGELVLS KVFYKSQKGH CEWAAKALVQ SAQDNFVTDD  240
ESREEKEDTQ LEKLSVNMAT ESNGNNQEQT LVEMYPDQDK PCSCKHVLDS ADVNHENQIN  300
DQAETELDHM SLQERYRILL ADMRSCSARV SAEKCALNDM GNSSMQMDAE TSGPVPKSES  360
EEKNHEGTAC MEDICSMLQE ISSAPSITDS MNDDNNVRLL GEIPPDTQIS SVECFVNTEG  420
PVNDKAFNSS AELRLSQTPA CGDENVQLAP RNSGTYLVDV KTEPALDGYA IYPPESPSVK  480
FHHSNDDGLK VSGSILECMP KDVEDSPPYL GVKSELSGYE LPGLCENSFI SSMEPIVKKP  540
HTRTLNCNGG LAPCSGAPKK KRKIAMDSSE KVLEEDACKN DEGIPYPSRQ KRKKKTATDS  600
IETALEEDAP GLLQILLDKG IVVNEIKLYD VVEDDEMLPD CTESDFQDLE NVITK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3724600.0AK372460.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3002I07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228958.10.0PREDICTED: uncharacterized protein LOC100826588 isoform X2
TrEMBLM0WF310.0M0WF31_HORVD; Uncharacterized protein
STRINGMLOC_50895.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25580.11e-33NAC family protein